Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006208-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006208-A01, RRID:AB_463602
- Product name
- RPS14 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length recombinant RPS14.
- Antigen sequence
MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFA
SFNDTFVHVTDLSGKETICRVTGGMKVKADRDESS
PYAAMLAAQDVAQRCRELGITALHIKLRATGGNRT
KTPGPGAQSALRALARSGMKIGRTEDVTPIPSDST
RRKGGRRGRRL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Haploinsufficiency for ribosomal protein genes causes selective activation of p53 in human erythroid progenitor cells.
Dexamethasone and lenalidomide have distinct functional effects on erythropoiesis.
Identification of RPS14 as a 5q- syndrome gene by RNA interference screen.
Dutt S, Narla A, Lin K, Mullally A, Abayasekara N, Megerdichian C, Wilson FH, Currie T, Khanna-Gupta A, Berliner N, Kutok JL, Ebert BL
Blood 2011 Mar 3;117(9):2567-76
Blood 2011 Mar 3;117(9):2567-76
Dexamethasone and lenalidomide have distinct functional effects on erythropoiesis.
Narla A, Dutt S, McAuley JR, Al-Shahrour F, Hurst S, McConkey M, Neuberg D, Ebert BL
Blood 2011 Aug 25;118(8):2296-304
Blood 2011 Aug 25;118(8):2296-304
Identification of RPS14 as a 5q- syndrome gene by RNA interference screen.
Ebert BL, Pretz J, Bosco J, Chang CY, Tamayo P, Galili N, Raza A, Root DE, Attar E, Ellis SR, Golub TR
Nature 2008 Jan 17;451(7176):335-9
Nature 2008 Jan 17;451(7176):335-9
No comments: Submit comment
No validations: Submit validation data