H00006208-A01

RPS14 antibody from Abnova Corporation
EMTB, S14
No application information provided.

Antibody data

Product number
H00006208-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006208-A01, RRID:AB_463602
Product name
RPS14 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00006208-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant RPS14.
Antigen sequence
MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFA
SFNDTFVHVTDLSGKETICRVTGGMKVKADRDESS
PYAAMLAAQDVAQRCRELGITALHIKLRATGGNRT
KTPGPGAQSALRALARSGMKIGRTEDVTPIPSDST
RRKGGRRGRRL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -