Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021002 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021002, RRID:AB_1850692
- Product name
- Anti-HIBADH
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDS
ATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVF
QFLR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Characterization of 3-hydroxyisobutyrate dehydrogenase, HIBADH, as a sperm-motility marker.
Tasi YC, Chao HC, Chung CL, Liu XY, Lin YM, Liao PC, Pan HA, Chiang HS, Kuo PL, Lin YH
Journal of assisted reproduction and genetics 2013 Apr;30(4):505-12
Journal of assisted reproduction and genetics 2013 Apr;30(4):505-12
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human kidney, liver, lymph node and placenta using Anti-HIBADH antibody HPA021002 (A) shows similar protein distribution across tissues to independent antibody HPA019522 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-HIBADH antibody HPA021002.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta using Anti-HIBADH antibody HPA021002.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node using Anti-HIBADH antibody HPA021002.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-HIBADH antibody HPA021002.
- Sample type
- HUMAN
