HPA019522

HIBADH antibody from Sigma-Aldrich
NS5ATP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019522
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019522, RRID:AB_1850690
Product name
Anti-HIBADH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019522
Antibody type
Polyclonal
Antigen
3-hydroxyisobutyrate dehydrogenase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVG
TGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPK
LLAKILNMS
Storage
-20C
Provider Type Product Number
- No reagents -