HPA021458

PRTFDC1 antibody from Atlas Antibodies
HHGP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021458
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021458, RRID:AB_1855793
Product name
Anti-PRTFDC1
Provider product page
Atlas Antibodies - HPA021458
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHY
YGDLEYVLIPHGIIVDRIERLA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -