HPA024302

ZNF704 antibody from MilliporeSigma / Merck KGaA
FLJ16218, Gig1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024302
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA024302, RRID:AB_1859427
Product name
Anti-ZNF704 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA024302
Antibody type
Polyclonal
Antigen
Zinc finger protein 704 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDLKRDCGKKMSHQHVFSLAMEEDVKTADTKKASR
ILDHEKENTRSICLLEQKRKVVSSNIDVPPARKSS
EELDMDKVTAAMVLT
Storage
-20C
Provider Type Product Number
- No reagents -