HPA024302

ZNF704 antibody from Sigma-Aldrich
FLJ16218, Gig1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024302
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024302, RRID:AB_1859427
Product name
Anti-ZNF704 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024302
Antibody type
Polyclonal
Antigen
Zinc finger protein 704 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDLKRDCGKKMSHQHVFSLAMEEDVKTADTKKASR
ILDHEKENTRSICLLEQKRKVVSSNIDVPPARKSS
EELDMDKVTAAMVLT
Storage
-20C
Provider Type Product Number
- No reagents -