HPA003364

RPS24 antibody from Sigma-Aldrich
S24
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003364
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003364, RRID:AB_1079847
Product name
Anti-RPS24 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003364
Antibody type
Polyclonal
Antigen
40S ribosomal protein S24 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMY
KTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAK
KNEPKHRLARHGLYEKKKTSRKQRKERKNRMK
Storage
-20C
Provider Type Product Number
- No reagents -