Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA026775 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA026775, RRID:AB_1857534
- Product name
- Anti-ST8SIA1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMED
CCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDN
STYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGR
QIDEANFVMRC- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Ganglioside GD3 regulates neural stem cell quiescence and controls postnatal neurogenesis.
Epigenetic hypomethylation and upregulation of GD3s in triple negative breast cancer
IKK inhibition by BMS-345541 suppresses breast tumorigenesis and metastases by targeting GD2+ cancer stem cells
Fuchigami T, Itokazu Y, Yu RK
bioRxiv : the preprint server for biology 2023 Mar 14;
bioRxiv : the preprint server for biology 2023 Mar 14;
Epigenetic hypomethylation and upregulation of GD3s in triple negative breast cancer
Li W, Zheng X, Ren L, Fu W, Liu J, Xv J, Liu S, Wang J, Du G
Annals of Translational Medicine 2019;7(23):723-723
Annals of Translational Medicine 2019;7(23):723-723
IKK inhibition by BMS-345541 suppresses breast tumorigenesis and metastases by targeting GD2+ cancer stem cells
Battula V, Nguyen K, Sun J, Pitner M, Yuan B, Bartholomeusz C, Hail N, Andreeff M
Oncotarget 2017;8(23):36936-36949
Oncotarget 2017;8(23):36936-36949
No comments: Submit comment
No validations: Submit validation data