HPA026775

ST8SIA1 antibody from Sigma-Aldrich
SIAT8, SIAT8A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026775
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026775, RRID:AB_1857534
Product name
Anti-ST8SIA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026775
Antibody type
Polyclonal
Antigen
Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMED
CCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDN
STYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGR
QIDEANFVMRC
Storage
-20C
Provider Type Product Number
- No reagents -