HPA003365

RPL3 antibody from Sigma-Aldrich
L3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003365
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003365, RRID:AB_1079841
Product name
Anti-RPL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003365
Antibody type
Polyclonal
Antigen
60S ribosomal protein L3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLPLR
QKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQ
VFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKT
HR
Storage
-20C
Provider Type Product Number
- No reagents -