HPA003368

RPLP1 antibody from Sigma-Aldrich
LP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003368
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003368, RRID:AB_1079845
Product name
Anti-RPLP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003368
Antibody type
Polyclonal
Antigen
60S acidic ribosomal protein P1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MASVSELACIYSALILHDDEVTVTEDKINALIKAA
GVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAP
AAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESD
DDMG
Storage
-20C
Provider Type Product Number
- No reagents -