Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [10]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182778 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SRY (Sex Determining Region Y)-Box 5 (SOX5) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SOX5 antibody: synthetic peptide directed towards the C terminal of human SOX5
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIY
DEYDE EEDDPDVDYG- Vial size
- 50 µg
Submitted references Similar properties of chondrocytes from osteoarthritis joints and mesenchymal stem cells from healthy donors for tissue engineering of articular cartilage.
Sonic Hedgehog-signalling patterns the developing chicken comb as revealed by exploration of the pea-comb mutation.
SHOX interacts with the chondrogenic transcription factors SOX5 and SOX6 to activate the aggrecan enhancer.
Array-based comparative genomic hybridization identifies CDK4 and FOXM1 alterations as independent predictors of survival in malignant peripheral nerve sheath tumor.
Transcriptional regulation of an axonemal central apparatus gene, sperm-associated antigen 6, by a SRY-related high mobility group transcription factor, S-SOX5.
Neoplasms with schwannian differentiation express transcription factors known to regulate normal schwann cell development.
Integration of neuronal clones in the radial cortical columns by EphA and ephrin-A signalling.
Sox5 can suppress platelet-derived growth factor B-induced glioma development in Ink4a-deficient mice through induction of acute cellular senescence.
Copy number variation in intron 1 of SOX5 causes the Pea-comb phenotype in chickens.
Exploiting orthologue diversity for systematic detection of gain-of-function phenotypes.
Fernandes AM, Herlofsen SR, Karlsen TA, Küchler AM, Fløisand Y, Brinchmann JE
PloS one 2013;8(5):e62994
PloS one 2013;8(5):e62994
Sonic Hedgehog-signalling patterns the developing chicken comb as revealed by exploration of the pea-comb mutation.
Boije H, Harun-Or-Rashid M, Lee YJ, Imsland F, Bruneau N, Vieaud A, Gourichon D, Tixier-Boichard M, Bed'hom B, Andersson L, Hallböök F
PloS one 2012;7(12):e50890
PloS one 2012;7(12):e50890
SHOX interacts with the chondrogenic transcription factors SOX5 and SOX6 to activate the aggrecan enhancer.
Aza-Carmona M, Shears DJ, Yuste-Checa P, Barca-Tierno V, Hisado-Oliva A, Belinchón A, Benito-Sanz S, Rodríguez JI, Argente J, Campos-Barros A, Scambler PJ, Heath KE
Human molecular genetics 2011 Apr 15;20(8):1547-59
Human molecular genetics 2011 Apr 15;20(8):1547-59
Array-based comparative genomic hybridization identifies CDK4 and FOXM1 alterations as independent predictors of survival in malignant peripheral nerve sheath tumor.
Yu J, Deshmukh H, Payton JE, Dunham C, Scheithauer BW, Tihan T, Prayson RA, Guha A, Bridge JA, Ferner RE, Lindberg GM, Gutmann RJ, Emnett RJ, Salavaggione L, Gutmann DH, Nagarajan R, Watson MA, Perry A
Clinical cancer research : an official journal of the American Association for Cancer Research 2011 Apr 1;17(7):1924-34
Clinical cancer research : an official journal of the American Association for Cancer Research 2011 Apr 1;17(7):1924-34
Transcriptional regulation of an axonemal central apparatus gene, sperm-associated antigen 6, by a SRY-related high mobility group transcription factor, S-SOX5.
Kiselak EA, Shen X, Song J, Gude DR, Wang J, Brody SL, Strauss JF 3rd, Zhang Z
The Journal of biological chemistry 2010 Oct 1;285(40):30496-505
The Journal of biological chemistry 2010 Oct 1;285(40):30496-505
Neoplasms with schwannian differentiation express transcription factors known to regulate normal schwann cell development.
Pytel P, Karrison T, Can Gong, Tonsgard JH, Krausz T, Montag AG
International journal of surgical pathology 2010 Dec;18(6):449-57
International journal of surgical pathology 2010 Dec;18(6):449-57
Integration of neuronal clones in the radial cortical columns by EphA and ephrin-A signalling.
Torii M, Hashimoto-Torii K, Levitt P, Rakic P
Nature 2009 Sep 24;461(7263):524-8
Nature 2009 Sep 24;461(7263):524-8
Sox5 can suppress platelet-derived growth factor B-induced glioma development in Ink4a-deficient mice through induction of acute cellular senescence.
Tchougounova E, Jiang Y, Bråsäter D, Lindberg N, Kastemar M, Asplund A, Westermark B, Uhrbom L
Oncogene 2009 Mar 26;28(12):1537-48
Oncogene 2009 Mar 26;28(12):1537-48
Copy number variation in intron 1 of SOX5 causes the Pea-comb phenotype in chickens.
Wright D, Boije H, Meadows JR, Bed'hom B, Gourichon D, Vieaud A, Tixier-Boichard M, Rubin CJ, Imsland F, Hallböök F, Andersson L
PLoS genetics 2009 Jun;5(6):e1000512
PLoS genetics 2009 Jun;5(6):e1000512
Exploiting orthologue diversity for systematic detection of gain-of-function phenotypes.
Martelli ML, Isella C, Mira A, Fu L, Cantarella D, Medico E
BMC genomics 2008 May 29;9:254
BMC genomics 2008 May 29;9:254
No comments: Submit comment
No validations: Submit validation data