Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405796 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Phosphoribosylformylglycinamidine Synthase (PFAS) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PFAS antibody: synthetic peptide directed towards the N terminal of human PFAS
- Description
- Affinity Purified
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRP
EDPTR PSRFQQQQGL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Hsp70/Hsp90 chaperone machinery is involved in the assembly of the purinosome.
Large-scale mapping of human protein-protein interactions by mass spectrometry.
French JB, Zhao H, An S, Niessen S, Deng Y, Cravatt BF, Benkovic SJ
Proceedings of the National Academy of Sciences of the United States of America 2013 Feb 12;110(7):2528-33
Proceedings of the National Academy of Sciences of the United States of America 2013 Feb 12;110(7):2528-33
Large-scale mapping of human protein-protein interactions by mass spectrometry.
Ewing RM, Chu P, Elisma F, Li H, Taylor P, Climie S, McBroom-Cerajewski L, Robinson MD, O'Connor L, Li M, Taylor R, Dharsee M, Ho Y, Heilbut A, Moore L, Zhang S, Ornatsky O, Bukhman YV, Ethier M, Sheng Y, Vasilescu J, Abu-Farha M, Lambert JP, Duewel HS, Stewart II, Kuehl B, Hogue K, Colwill K, Gladwish K, Muskat B, Kinach R, Adams SL, Moran MF, Morin GB, Topaloglou T, Figeys D
Molecular systems biology 2007;3:89
Molecular systems biology 2007;3:89
No comments: Submit comment
No validations: Submit validation data