H00009586-B01P

CREB5 antibody from Abnova Corporation
CRE-BPA, H_GS165L15.1

Antibody data

Product number
H00009586-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009586-B01P, RRID:AB_1573186
Product name
CREB5 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00009586-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CREB5 protein.
Antigen sequence
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMI
HRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLKNCE
EVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAV
GGAMTGPGTHQLSSARLPNHDTNVVIQQAMPSPQS
SSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPM
PASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMG
MQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPA
AMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQ
HQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHH
SHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQM
QPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERN
RAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLS
PESSPPASPVPACSQQQVIQHNTITTSSSVSEVVG
SSTLSQLTTHRTDLNPIL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -