H00009586-D01

CREB5 antibody from Abnova Corporation
CRE-BPA, H_GS165L15.1

Antibody data

Product number
H00009586-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009586-D01, RRID:AB_10658472
Product name
CREB5 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00009586-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human CREB5 protein.
Antigen sequence
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMI
HRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLKNCE
EVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAV
GGAMTGPGTHQLSSARLPNHDTNVVIQQAMPSPQS
SSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPM
PASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMG
MQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPA
AMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQ
HQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHH
SHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQM
QPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERN
RAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLS
PESSPPASPVPACSQQQVIQHNTITTSSSVSEVVG
SSTLSQLTTHRTDLNPIL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -