Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008462-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008462-M03, RRID:AB_894165
- Product name
- KLF11 monoclonal antibody (M03), clone 10D8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KLF11.
- Antigen sequence
TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARS
DELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHA
RRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSM
PASA- Isotype
- IgG
- Antibody clone number
- 10D8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- KLF11 monoclonal antibody (M03), clone 10D8 Western Blot analysis of KLF11 expression in NIH/3T3 ( Cat # L018V1 ).
- Validation comment
- Western Blot (Cell lysate)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- KLF11 monoclonal antibody (M03), clone 10D8. Western Blot analysis of KLF11 expression in PC-12.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of KLF11 expression in transfected 293T cell line by KLF11 monoclonal antibody (M03), clone 10D8.Lane 1: KLF11 transfected lysate (Predicted MW: 55.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to KLF11 on NIH/3T3 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to KLF11 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol