WH0064093M3

SMOC1 antibody from Sigma-Aldrich
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
WH0064093M3
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0064093M3, RRID:AB_1843675
Product name
Monoclonal Anti-SMOC1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0064093M3
Antibody type
Monoclonal
Antigen
SMOC1 (NP_071420, a.a. 150-222) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
SVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPT
METQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIR
NS* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -