Antibody data

Product number
H00064093-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064093-M03, RRID:AB_530203
Product name
SMOC1 monoclonal antibody (M03), clone 8F10
Provider product page
Abnova Corporation - H00064093-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SMOC1.
Antigen sequence
SVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPT
METQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIR
NS
Isotype
IgG
Antibody clone number
8F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -