H00064093-A01

SMOC1 antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00064093-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064093-A01, RRID:AB_607069
Product name
SMOC1 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00064093-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant SMOC1.
Antigen sequence
SVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPT
METQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIR
NS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -