Antibody data

Product number
PAB22333
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22333, RRID:AB_10964754
Product name
ZNF660 polyclonal antibody
Provider product page
Abnova Corporation - PAB22333
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ZNF660.
Antigen sequence
KTRNFKHKTVKDNKVLTEGSDQESEKDNSQCCDPA
TNERVQAEKRQYVCTECGKAFSQSANLTVHERIHT
GEK
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -