Antibody data

Product number
ABIN1449808
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 660 (ZNF660) (C-Term) antibody
Provider product page
antibodies-online - ABIN1449808
Antibody type
Polyclonal
Antigen
A synthetic peptide directed towards the C-terminal region of human ZNF660
Description
Protein A affinity column
Reactivity
Human, Mouse, Rat, Canine
Host
Rabbit
Antigen sequence
TFRQTSQVILHLRTHTKEKPYKCSECGKAYRYSSQ
LIQHQRKHNEEKETS
Epitope
C-Term
Vial size
0.1 mg
Concentration
1.0 mg/mL after reconstitution
Storage
Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or (in aliquots) at -20°C long term.
Handling
Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -