AV36242

ZNF660 antibody from Sigma-Aldrich
FLJ36870
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV36242
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV36242, RRID:AB_1859397
Product name
Anti-ZNF660 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV36242
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF660 with an internal ID of P07601
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
TFRQTSQVILHLRTHTKEKPYKCSECGKAYRYSSQ
LIQHQRKHNEEKETS
Storage
-20C
Provider Type Product Number
- No reagents -