HPA029705

ZNF660 antibody from Sigma-Aldrich
FLJ36870
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029705
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA029705, RRID:AB_10602592
Product name
Anti-ZNF660 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA029705
Antibody type
Polyclonal
Antigen
zinc finger protein 660 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTRNFKHKTVKDNKVLTEGSDQESEKDNSQCCDPA
TNERVQAEKRQYVCTECGKAFSQSANLTVHERIHT
GEK
Storage
-20C
Provider Type Product Number
- No reagents -