HPA003373

RPL23 antibody from Sigma-Aldrich
L23, rpL17
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003373
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003373, RRID:AB_1856436
Product name
Anti-RPL23 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003373
Antibody type
Polyclonal
Antigen
60S ribosomal protein L23 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLN
RLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQR
KSYRRKDGV
Storage
-20C
Provider Type Product Number
- No reagents -