HPA023870

CDR2 antibody from Sigma-Aldrich
CDR62, Yo
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023870
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023870, RRID:AB_1846459
Product name
Anti-CDR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023870
Antibody type
Polyclonal
Antigen
Cerebellar degeneration-related protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSP
GKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKI
TSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKR
VTMEEEYGLVLKENSELE
Storage
-20C
Provider Type Product Number
- No reagents -