HPA006124

RPS12 antibody from MilliporeSigma / Merck KGaA
S12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006124
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006124, RRID:AB_1856460
Product name
Anti-RPS12 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006124
Antibody type
Polyclonal
Antigen
40S ribosomal protein S12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AAGGVMDVNTALQEVLKTALIHDGLARGIREAAKA
LDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINL
IKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVV
KDYGKESQAKDV
Storage
-20C
Provider Type Product Number
- No reagents -