HPA026813

SPINK2 antibody from Sigma-Aldrich
HUSI-II
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026813
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026813, RRID:AB_1857446
Product name
Anti-SPINK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026813
Antibody type
Polyclonal
Antigen
Serine protease inhibitor Kazal-type 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECT
LCMKIREGGHNIKIIRNGPC
Storage
-20C
Provider Type Product Number
- No reagents -