Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184230 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-GABRD antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSN
LEISW LPNLDGLIAG- Vial size
- 50 µg
Submitted references The human gamma-aminobutyric acid A receptor delta (GABRD) gene: molecular characterisation and tissue-specific expression.
Assignment of the human GABAA receptor delta-subunit gene (GABRD) to chromosome band 1p36.3 distal to marker NIB1364 by radiation hybrid mapping.
Windpassinger C, Kroisel PM, Wagner K, Petek E
Gene 2002 Jun 12;292(1-2):25-31
Gene 2002 Jun 12;292(1-2):25-31
Assignment of the human GABAA receptor delta-subunit gene (GABRD) to chromosome band 1p36.3 distal to marker NIB1364 by radiation hybrid mapping.
Emberger W, Windpassinger C, Petek E, Kroisel PM, Wagner K
Cytogenetics and cell genetics 2000;89(3-4):281-2
Cytogenetics and cell genetics 2000;89(3-4):281-2
No comments: Submit comment
No validations: Submit validation data