HPA003403

RPL12 antibody from Sigma-Aldrich
L12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003403
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003403, RRID:AB_1856432
Product name
Anti-RPL12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003403
Antibody type
Polyclonal
Antigen
60S ribosomal protein L12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDD
IAKATGDWKGLRITVKLTIQNRQAQIEVVPSASAL
IIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQ
MRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHD
IIDD
Storage
-20C
Provider Type Product Number
- No reagents -