HPA011311

antibody from Atlas Antibodies

Targeting: RPL10 DXS648, DXS648E, FLJ23544, L10, NOV, QM

Antibody data

Submit

Validation data

Product number: HPA011311 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA011311, RRID:AB_1856431
Product name: Anti-RPL10
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KMSSCAGADRLQTGMRGAFGKPQGTVARVHIGQVI MSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKK WGFTKFNADEFEDMVAEKRLIPDGCGVKYIPSRGP LDKWW
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RPL10 protein structure - HPA011311 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and cerebral cortex tissues using HPA011311 antibody. Corresponding RPL10 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Sample type: HUMAN