HPA011311

RPL10 antibody from Sigma-Aldrich
DXS648, DXS648E, FLJ23544, L10, NOV, QM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011311
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011311, RRID:AB_1856431
Product name
Anti-RPL10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011311
Antibody type
Polyclonal
Antigen
QM protein homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KMSSCAGADRLQTGMRGAFGKPQGTVARVHIGQVI
MSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKK
WGFTKFNADEFEDMVAEKRLIPDGCGVKYIPSRGP
LDKWW
Storage
-20C
Provider Type Product Number
- No reagents -