HPA019231

ACTL9 antibody from Sigma-Aldrich
MGC33407
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019231
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019231, RRID:AB_1853883
Product name
Anti-AC093230.2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019231
Antibody type
Polyclonal
Antigen
Actin-like protein 7C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MDASRPKSSESQSSLEAPRPGPNPSPNVVNKPLQR
DFPGMVADRLPPKTGAVVIDMGTGTCKVGFAGQAS
PTYTVATILGCQPKKPATSGQSGL
Storage
-20C
Provider Type Product Number
- No reagents -