HPA021613

RIBC1 antibody from Sigma-Aldrich
FLJ32783
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021613
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021613, RRID:AB_1848880
Product name
Anti-RIBC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021613
Antibody type
Polyclonal
Antigen
RIB43A-like with coiled-coils protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KERQNRFFNVRNRVMGVDVQALNNQVGDRKRREAA
ERSKEAAYGTSQVQYDVVVQMLEKEEADRTRQLAK
KVQEFREQKQQLKNGREFSLWDPGQVWKGLPTYLS
YSNTYPGPASLQYFS
Storage
-20C
Provider Type Product Number
- No reagents -