HPA018989

CHN2 antibody from Sigma-Aldrich
ARHGAP3, RhoGAP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018989
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018989, RRID:AB_1846681
Product name
Anti-CHN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018989
Antibody type
Polyclonal
Antigen
Beta-chimaerin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEA
PRPKRIICPREVENRPKY
Storage
-20C
Provider Type Product Number
- No reagents -