HPA018989

CHN2 antibody from Atlas Antibodies
ARHGAP3, RhoGAP3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018989
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018989, RRID:AB_1846681
Product name
Anti-CHN2
Provider product page
Atlas Antibodies - HPA018989
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEA
PRPKRIICPREVENRPKY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -