Antibody data

Product number
H00124751-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00124751-B01, RRID:AB_1204621
Product name
LOC124751 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00124751-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human LOC124751 protein.
Antigen sequence
MPSFLVPSLVSSPVLLKLLFSPGPKTIWSLWQQPM
LFQEATAFENMTKDWNYLEGSQKDCYRDTMLDSYE
NTVPQGSFLQLSMMPQRAGNDPPGVSNASEMEMEI
SNMREKFLMSVTKLVESKSYNSKVFSKEKYFQTIK
EVKEAKEKGKKSSRDYRRAAKYDVISVQGTEKLIE
ATHGERDRIRYYVHKEELFDILHDTHLSIGHGGRT
RMLKELQGKYGNVTKEVIVLYLTLCKQCHQKNPVP
KRGLAPKPMTFKDIDSTCQVEILDMQSSADGEFKF
ILYYQDHSTKFIILRPLRTKQAHEVVSVLLDIFTI
LGTPSVLDSDSGVEFTNQVVHELNELWPDLKIVSG
KYHPGQSQGSLEGASRDVKNMISTWMQSNHSCHWA
KGLRFMQMVRNQAFDVSLQQSPFEAMFGYKAKFGL
YSSNLPRETVATLQTEEELEIAEEQLENSLWIRQE
ERAEIGADRSDMDDDMDPTPEASEPSTSQGTSGLL
CW
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -