HPA022849

KRBA2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022849
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022849, RRID:AB_1852996
Product name
Anti-KRBA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022849
Antibody type
Polyclonal
Antigen
KRAB-A domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVLDSDSGVEFTNQVVHELNELWPDLKIVSGKYHP
GQSQGSLEGASRDVKNMISTWMQSNHSCHWAKGLR
FMQMVRNQAFDVSL
Storage
-20C
Provider Type Product Number
- No reagents -