Antibody data

Product number
H00006175-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006175-M01, RRID:AB_1580262
Product name
RPLP0 monoclonal antibody (M01), clone 1B4
Provider product page
Abnova Corporation - H00006175-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RPLP0.
Antigen sequence
MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNV
GSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLE
NNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLAN
KVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQA
LGITTKISRGTIEILSDVQLIKTGDKVGASEATLL
NMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEET
LHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGY
KRVLALSVETDYTFPLAEKVKAFLADPSAFVAAAP
VAAATTAAPAAAAAPAKVEAKEESEESDEDMGFGL
FD
Isotype
IgG
Antibody clone number
1B4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -