HPA023383

ZFAND1 antibody from Sigma-Aldrich
FLJ14007
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023383
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023383, RRID:AB_1859008
Product name
Anti-ZFAND1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023383
Antibody type
Polyclonal
Antigen
AN1-type zinc finger protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QHCQVEHCRQRDFLPFVCDDCSGIFCLEHRSRESH
GCPEVTVINERLKTDQHTSYPCSFKDCAERELVAV
ICP
Storage
-20C
Provider Type Product Number
- No reagents -