HPA023799

CHMP4C antibody from Atlas Antibodies
MGC22825, Shax3, VPS32C
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023799
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023799, RRID:AB_1846670
Product name
Anti-CHMP4C
Provider product page
Atlas Antibodies - HPA023799
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEM
LGKKQEYLENRIQREIALAKKHGTQN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -