H00092421-B01P

CHMP4C antibody from Abnova Corporation
MGC22825, Shax3, VPS32C

Antibody data

Product number
H00092421-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00092421-B01P, RRID:AB_1573050
Product name
CHMP4C purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00092421-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CHMP4C protein.
Antigen sequence
MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEM
LGKKQEYLENRIQREIALAKKHGTQNKRAALQALK
RKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEV
LRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQD
IAQEISEAFSQRVGFGDDFDEDELMAELEELEQEE
LNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRS
RAASSQRAEEEDDDIKQLAAWAT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -