HPA023799

CHMP4C antibody from Sigma-Aldrich
MGC22825, Shax3, VPS32C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023799
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023799, RRID:AB_1846670
Product name
Anti-CHMP4C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023799
Antibody type
Polyclonal
Antigen
Charged multivesicular body protein 4c recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEM
LGKKQEYLENRIQREIALAKKHGTQN
Storage
-20C
Provider Type Product Number
- No reagents -