HPA002815

UQCRC1 antibody from Sigma-Aldrich
D3S3191, QCR1, UQCR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002815
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002815, RRID:AB_1080486
Product name
Anti-UQCRC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002815
Antibody type
Polyclonal
Antigen
Ubiquinol-cytochrome-c reductase complex core protein 1, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDIVQNCSLEDSQIEKERDVILREMQENDASMRDV
VFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLT
EYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGG
Storage
-20C
Provider Type Product Number
- No reagents -