Antibody data

Product number
H00064089-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064089-M07, RRID:AB_1237876
Product name
SNX16 monoclonal antibody (M07), clone 1E9
Provider product page
Abnova Corporation - H00064089-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SNX16.
Antigen sequence
MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVST
SSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSS
PLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWED
RPSTPTILGYEVMEERAKFTVYKILVKKTPEESWV
VFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDN
YNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREF
LCLDDPPGPFDSLEESRAFCETLEETNYRLQKELL
EKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPE
ESLDVSETEGEQILKVESSALEVDQDVLDEESRAD
NKPCLSFSEPENAVSEIEVAEVAYDAEED
Isotype
IgG
Antibody clone number
1E9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -