HPA024731

SNX16 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024731
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024731, RRID:AB_1857346
Product name
Anti-SNX16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024731
Antibody type
Polyclonal
Antigen
Sorting nexin-16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLHIDTLENRIRTLSLEPEESLDVSETEGEQILKV
ESSALEVDQDVLDEESRADNKPCLSFSEPENAVS
Storage
-20C
Provider Type Product Number
- No reagents -