HPA002817

NDUFB7 antibody from Sigma-Aldrich
B18, CI-B18, MGC2480
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002817
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002817, RRID:AB_1079462
Product name
Anti-NDUFB7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002817
Antibody type
Polyclonal
Antigen
NADH dehydrogenase (ubiquinone) 1beta-subcomplex subunit 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIR
LLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMK
EFERERRLLQRKKRREKKAAELAKGQGPGEVDPKV
Storage
-20C
Provider Type Product Number
- No reagents -