Antibody data

Product number
H00010781-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010781-M02, RRID:AB_1137547
Product name
ZNF266 monoclonal antibody (M02), clone 4G5
Provider product page
Abnova Corporation - H00010781-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF266.
Antigen sequence
GRAFTVSSCLSQHMKIHVGEKPYECKECGIAFTRS
SQLTEHLKTHTAKDPFECKICGKSFRNSSCLSDHF
RIH
Isotype
IgG
Antibody clone number
4G5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -