HPA002871

ZNF410 antibody from Sigma-Aldrich
APA-1, APA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002871
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002871, RRID:AB_1080712
Product name
Anti-ZNF410 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002871
Antibody type
Polyclonal
Antigen
Zinc finger protein 410 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VQFVQNTSIPLGQGLVESEAKDITCLSLLPVTEAS
ECSRLMLPDDTTNHSNSSKEVPSSAVLRSLRVNVG
PDGEETRAQTVQKSPEFLSTSESSSLLQDLQPSDS
TSFILLNLTRAGL
Storage
-20C
Provider Type Product Number
- No reagents -