HPA002866

SSBP1 antibody from Sigma-Aldrich
mtSSB, SSBP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002866
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002866, RRID:AB_1080092
Product name
Anti-SSBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002866
Antibody type
Polyclonal
Antigen
Single-stranded DNA-binding protein, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQ
DPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLG
DVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLE
GKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKE
Storage
-20C
Provider Type Product Number
- No reagents -