HPA036182

EXOSC7 antibody from Atlas Antibodies
EAP1, hRrp42p, KIAA0116, p8, RRP42, Rrp42p
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA036182
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA036182, RRID:AB_10673346
Product name
Anti-EXOSC7
Provider product page
Atlas Antibodies - HPA036182
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PCIVTLCKIGYRHVVDATLQEEACSLASLLVSVTS
KGVVTCMRKVGKGSLDPESIFEMMETGKRVGKVLH
ASLQSVLHKEESLGPKRQKVGFLG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -