H00023016-B01

EXOSC7 antibody from Abnova Corporation
EAP1, hRrp42p, KIAA0116, p8, RRP42, Rrp42p

Antibody data

Product number
H00023016-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023016-B01, RRID:AB_1113653
Product name
EXOSC7 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00023016-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human EXOSC7 protein.
Antigen sequence
MASVTLSEAEKVYIVHGVQEDLRVDGRGCEDYRCV
EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPK
LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEI
ANTLYRIFNNKSSVDLKTLCISPREHCWVLYVDVL
LLECGGNLFDAISIAVKAALFNTRIPRVRVLEDEE
GSKDIELSDDPYDCIRLSVENVPCIVTLCKIGYRH
VVDATLQEEACSLASLLVSVTSKGVVTCMRKVGKG
SLDPESIFEMMETGKRVGKVLHASLQSVLHKEESL
GPKRQKVGFLG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -